PDB entry 1ygt

View 1ygt on RCSB PDB site
Description: Dynein Light Chain TcTex-1
Deposited on 2005-01-05, released 2005-02-15
The last revision was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic dynein light chain
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Dlc90F, Tctex
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ygtA (A:)
    mddsreesqfivddvsktikeaiettiggnayqhdkvnnwtgqvvencltvltkeqkpyk
    yivtamimqkngaglhtasscywnndtdgsctvrwenktmycivsvfglav
    

    Sequence, based on observed residues (ATOM records):
    >1ygtA (A:)
    sqfivddvsktikeaiettiggnayqhdkvnnwtgqvvencltvltkeqkpykyivtami
    mqkngaglhtasscywnndtdgsctvrwenktmycivsvfglav