PDB entry 1ygs

View 1ygs on RCSB PDB site
Description: crystal structure of the smad4 tumor suppressor c-terminal domain
Class: tumour suppressor
Keywords: smad4, tumor suppressor c-terminal domain, tgf-beta signal mediator, beta-sandwich scaffold with a three-helix bundle, tumour suppressor
Deposited on 1997-10-03, released 1998-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ygsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ygsA (A:)
    apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier
    arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf
    dlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvddlrrl
    cilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ygsA (A:)
    apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier
    arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf
    dlrqchrqmqqqaataqavddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhral
    qlldevlhtm