PDB entry 1ygp

View 1ygp on RCSB PDB site
Description: phosphorylated form of yeast glycogen phosphorylase with phosphate bound in the active site.
Class: glycosyltransferase
Keywords: yeast, phosphorylated form, glycosyltransferase
Deposited on 1996-05-30, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.179
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast glycogen phosphorylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YEAST GLYCOGEN PHOSPHORYLASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06738 (27-878)
      • conflict (24)
      • conflict (66)
      • conflict (144)
      • conflict (289-290)
      • conflict (302)
      • conflict (439)
      • conflict (643)
    Domains in SCOPe 2.07: d1ygpa_
  • Chain 'B':
    Compound: yeast glycogen phosphorylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YEAST GLYCOGEN PHOSPHORYLASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06738 (27-878)
      • conflict (24)
      • conflict (66)
      • conflict (144)
      • conflict (289-290)
      • conflict (302)
      • conflict (439)
      • conflict (643)
    Domains in SCOPe 2.07: d1ygpb_
  • Heterogens: PO4, PLP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ygpA (A:)
    prltrrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarsl
    yncddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmk
    iedpedpaaskgkpremikgaldelgfkledvldqepdaglgngglgrlaacfvdsmate
    gipawgyglryeygifaqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpe
    ggkttlsasqwiggervlavaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdykn
    svaqqqraesitavlypndnfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdq
    vaiqlndthptlaivelqrvlvdlekldwheawdivtktfaytnhtvmqealekwprrlf
    ghllprhleiiydinwffledvakkfpkdvdllsrisiieensperqirmaflaivgshk
    vngvvelhselikttifkdfikfygpskfvnvtngitprrwlkqanpslaklisetlndp
    teeylldmakltqlekyvedkeflkkwnqvklnnkirlvdlikkendgvdiinreylddt
    lfdmqvkriheykrqqlnvfgiiyrylamknmlkngasieevarkyprkvsifggksapg
    yymakliiklincvadivnndesiehllkvvfvadynvskaeiiipasdlsehistagte
    asgtsnmkfvmnggliigtvdganveitreigednvflfgnlsenveelrynhqyhpqdl
    pssldsvlsyiesgqfspenpnefkplvdsikyhgdyylvsddfesylathelvdqefhn
    qrsewlkksvlslanvgffssdrcieeysdtiwnvepvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ygpA (A:)
    trrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarslync
    ddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmkipr
    emikgaldelgfkledvldqepdaglgngglgrlaacfvdsmategipawgyglryeygi
    faqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpttlsasqwiggervla
    vaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdyknsvaqqqraesitavlypnd
    nfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdqvaiqlndthptlaivelqr
    vlvdlekldwheawdivtktfaytnhtvmqealekwprrlfghllprhleiiydinwffl
    edvakkfpkdvdllsrisiieensperqirmaflaivgshkvngvvelhselikttifkd
    fikfygpskfvnvtngitprrwlkqanpslaklisetlndpteeylldmakltqlekyve
    dkeflkkwnqvklnnkirlvdlikkendgvdiinreylddtlfdmqvkriheykrqqlnv
    fgiiyrylamknmlkngasieevarkyprkvsifggksapgyymakliiklincvadivn
    ndesiehllkvvfvadynvskaeiiipasdlsehistagteasgtsnmkfvmnggliigt
    vdganveitreigednvflfgnlsenveelrynhqyhpqdlpssldsvlsyieqfspenp
    nefkplvdsikyhgdyylvsddfesylathelvdqefhnqrsewlkksvlslanvgffss
    drcieeysdtiwnvepvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ygpB (B:)
    prltrrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarsl
    yncddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmk
    iedpedpaaskgkpremikgaldelgfkledvldqepdaglgngglgrlaacfvdsmate
    gipawgyglryeygifaqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpe
    ggkttlsasqwiggervlavaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdykn
    svaqqqraesitavlypndnfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdq
    vaiqlndthptlaivelqrvlvdlekldwheawdivtktfaytnhtvmqealekwprrlf
    ghllprhleiiydinwffledvakkfpkdvdllsrisiieensperqirmaflaivgshk
    vngvvelhselikttifkdfikfygpskfvnvtngitprrwlkqanpslaklisetlndp
    teeylldmakltqlekyvedkeflkkwnqvklnnkirlvdlikkendgvdiinreylddt
    lfdmqvkriheykrqqlnvfgiiyrylamknmlkngasieevarkyprkvsifggksapg
    yymakliiklincvadivnndesiehllkvvfvadynvskaeiiipasdlsehistagte
    asgtsnmkfvmnggliigtvdganveitreigednvflfgnlsenveelrynhqyhpqdl
    pssldsvlsyiesgqfspenpnefkplvdsikyhgdyylvsddfesylathelvdqefhn
    qrsewlkksvlslanvgffssdrcieeysdtiwnvepvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ygpB (B:)
    trrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarslync
    ddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmkipr
    emikgaldelgfkledvldqepdaglgngglgrlaacfvdsmategipawgyglryeygi
    faqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpttlsasqwiggervla
    vaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdyknsvaqqqraesitavlypnd
    nfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdqvaiqlndthptlaivelqr
    vlvdlekldwheawdivtktfaytnhtvmqealekwprrlfghllprhleiiydinwffl
    edvakkfpkdvdllsrisiieensperqirmaflaivgshkvngvvelhselikttifkd
    fikfygpskfvnvtngitprrwlkqanpslaklisetlndpteeylldmakltqlekyve
    dkeflkkwnqvklnnkirlvdlikkendgvdiinreylddtlfdmqvkriheykrqqlnv
    fgiiyrylamknmlkngasieevarkyprkvsifggksapgyymakliiklincvadivn
    ndesiehllkvvfvadynvskaeiiipasdlsehistagteasgtsnmkfvmnggliigt
    vdganveitreigednvflfgnlsenveelrynhqyhpqdlpssldsvlsyieqfspenp
    nefkplvdsikyhgdyylvsddfesylathelvdqefhnqrsewlkksvlslanvgffss
    drcieeysdtiwnvepvt