PDB entry 1ygm

View 1ygm on RCSB PDB site
Description: NMR structure of Mistic
Deposited on 2005-01-05, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU31320
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: YugO-a
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05247 (Start-113)
      • cloning artifact (114-117)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ygmA (A:)
    gshgmfctffekhhrkwdillekstgvmeamkvtseekeqlstaidrmnegldafiqlyn
    eseidepliqldddtaelmkqardmygqeklneklntiikqilsisvseegekelvpr
    

    Sequence, based on observed residues (ATOM records):
    >1ygmA (A:)
    ctffekhhrkwdillekstgvmeamkvtseekeqlstaidrmnegldafiqlyneseide
    pliqldddtaelmkqardmygqeklneklntiikqilsisvseegekelvpr