PDB entry 1ygh

View 1ygh on RCSB PDB site
Description: hat domain of gcn5 from saccharomyces cerevisiae
Deposited on 1999-05-27, released 1999-08-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-02, with a file datestamp of 1999-08-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ygha_
  • Chain 'B':
    Domains in SCOP 1.55: d1yghb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yghA (A:)
    kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
    ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
    gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yghB (B:)
    kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
    ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
    gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld