PDB entry 1yge

View 1yge on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 100k
Deposited on 1996-06-04, released 1997-07-23
The last revision prior to the SCOP 1.57 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yge_ (-)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi