PDB entry 1yge

View 1yge on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 100k
Class: dioxygenase
Keywords: dioxygenase, lipoxygenase, metalloprotein, fatty acids
Deposited on 1996-06-04, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ygea1, d1ygea2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ygeA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi