PDB entry 1yg9

View 1yg9 on RCSB PDB site
Description: The structure of mutant (N93Q) of bla g 2
Class: hydrolase, allergen
Keywords: Bla g 2, Allegren, HYDROLASE, ALLERGEN
Deposited on 2005-01-04, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.181
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartic protease Bla g 2
    Species: Blattella germanica [TaxId:6973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54958 (8-327)
      • cloning artifact (0-3)
      • engineered (96)
      • modified residue (295)
    Domains in SCOPe 2.07: d1yg9a1, d1yg9a2
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yg9A (A:)
    gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
    yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
    dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv
    dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
    cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
    hffigdffvdhyysefnwenktmgfgrsve