PDB entry 1yg8

View 1yg8 on RCSB PDB site
Description: The structure of a V6A variant of ClpP.
Class: hydrolase
Keywords: Endopeptidase Clp, Caseinolytic protease, Protease Ti, Heat shock protein F21.5, HYDROLASE
Deposited on 2005-01-04, released 2006-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8n_
  • Chain 'O':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8o_
  • Chain 'P':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8p_
  • Chain 'Q':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8q_
  • Chain 'R':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8r_
  • Chain 'S':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8s_
  • Chain 'T':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8t_
  • Chain 'U':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8u_
  • Chain 'V':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8v_
  • Chain 'W':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8w_
  • Chain 'X':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8x_
  • Chain 'Y':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8y_
  • Chain 'Z':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yg8z_
  • Chain 'a':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Escherichia coli [TaxId:562]
    Gene: clpP, lopP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yg8A (A:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8A (A:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yg8B (B:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8B (B:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yg8C (C:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8C (C:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yg8D (D:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8D (D:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yg8E (E:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8E (E:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yg8F (F:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8F (F:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yg8G (G:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8G (G:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yg8H (H:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8H (H:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yg8I (I:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8I (I:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yg8J (J:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8J (J:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1yg8K (K:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8K (K:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1yg8L (L:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8L (L:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1yg8M (M:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8M (M:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1yg8N (N:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8N (N:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1yg8O (O:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8O (O:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1yg8P (P:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8P (P:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1yg8Q (Q:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8Q (Q:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1yg8R (R:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8R (R:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1yg8S (S:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8S (S:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1yg8T (T:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8T (T:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1yg8U (U:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8U (U:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1yg8V (V:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8V (V:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1yg8W (W:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8W (W:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1yg8X (X:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8X (X:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1yg8Y (Y:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8Y (Y:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1yg8Z (Z:)
    alapmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
    lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
    ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
    eyglvdsilthrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg8Z (Z:)
    rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
    siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
    ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.