PDB entry 1yg2

View 1yg2 on RCSB PDB site
Description: Structure of the Vibrio cholerae virulence activator AphA
Class: transcription
Keywords: virulence factor; vibrio cholerae; winged helix; transcription factor, TRANSCRIPTION
Deposited on 2005-01-04, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene activator AphA
    Species: Vibrio cholerae [TaxId:666]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yg2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yg2A (A:)
    mslphviltvlstrdatgyditkefsasigyfwkashqqvyrelnkmgeqglvtcvlepq
    egkpdrkvysitqagrsalgewfdqptahptvrdefsaklmacsvqsaepyrlqlaelve
    esrklvahyqeieaayyanpavldkqqrlerltlrrnllvrqawiqwadevlaelnama
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yg2A (A:)
    slphviltvlstrdatgyditkefsasigyfwkashqqvyrelnkmgeqglvtcvlevys
    itqagrsalgewfdqptahptvrdefsaklmacsvqsaepyrlqlaelveesrklvahyq
    eieaayyanpavldkqqrlerltlrrnllvrqawiqwadevlaelnama