PDB entry 1yg0

View 1yg0 on RCSB PDB site
Description: Solution structure of apo-CopP from Helicobacter pylori
Deposited on 2005-01-04, released 2006-01-24
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COP associated protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: copP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yg0A (A:)
    mkatfqvpsitcnhcvdkiekfvgeiegvsfidvsvekksvvvefdapatqdlikealld
    agqevv