PDB entry 1yfz

View 1yfz on RCSB PDB site
Description: Novel IMP Binding in Feedback Inhibition of Hypoxanthine-Guanine Phosphoribosyltransferase from Thermoanaerobacter tengcongensis
Class: transferase
Keywords: protein-nucleotide complex, transferase
Deposited on 2005-01-04, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: THERMOANAEROBACTER TENGCONGENSIS [TaxId:273068]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R7L0
      • engineered (76)
      • engineered (90)
    Domains in SCOPe 2.07: d1yfza1
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: THERMOANAEROBACTER TENGCONGENSIS [TaxId:273068]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R7L0
      • engineered (76)
      • engineered (90)
    Domains in SCOPe 2.07: d1yfzb_
  • Heterogens: ACT, MG, IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfzA (A:)
    masmtggqqmgrgsstslykkaglmpspmedieeiliteeqlkakvkelgemitrdyegk
    dlvligvlkgaimfmsglsraidlplsidflavssygsstkssgivkiikdhdidiegkd
    vlivediidsgltlaylretllgrkprslkictildkperreadvkvdycgfkipdkfvv
    gygldyaekyrnlpfigvlkpelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfzA (A:)
    spmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpl
    sidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkp
    rslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfzB (B:)
    masmtggqqmgrgsstslykkaglmpspmedieeiliteeqlkakvkelgemitrdyegk
    dlvligvlkgaimfmsglsraidlplsidflavssygsstkssgivkiikdhdidiegkd
    vlivediidsgltlaylretllgrkprslkictildkperreadvkvdycgfkipdkfvv
    gygldyaekyrnlpfigvlkpelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfzB (B:)
    pmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpls
    idflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkpr
    slkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely