PDB entry 1yfy

View 1yfy on RCSB PDB site
Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 3-hydroxyanthranilic acid
Class: oxidoreductase
Keywords: cupin, OXIDOREDUCTASE
Deposited on 2005-01-04, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.249
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-hydroxyanthranilate-3,4-dioxygenase
  Species: Cupriavidus metallidurans [TaxId:119219]
  Database cross-references and differences (RAF-indexed):
  • GB ZP_00274330 (0-173)
  Domains in SCOPe 2.07: d1yfya1
• Heterogens: FE, TRS, 3HA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yfyA (A:)
  mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
  qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
  fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa