PDB entry 1yfx

View 1yfx on RCSB PDB site
Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and NO
Class: oxidoreductase
Keywords: cupin
Deposited on 2005-01-04, released 2005-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-hydroxyanthranilate-3,4-dioxygenase
  Species: Ralstonia metallidurans
  Database cross-references and differences (RAF-indexed):
  • GB ZP_00274330 (0-173)
  Domains in SCOP 1.73: d1yfxa1
• Heterogens: FE, NO, TRS, 4AA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yfxA (A:)
  mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
  qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
  fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa