PDB entry 1yfw

View 1yfw on RCSB PDB site
Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and O2
Class: oxidoreductase
Keywords: cupin, OXIDOREDUCTASE
Deposited on 2005-01-04, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate-3,4-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00274330 (0-173)
    Domains in SCOPe 2.07: d1yfwa_
  • Heterogens: FE, OXY, TRS, 4AA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfwA (A:)
    mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
    qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
    fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa