PDB entry 1yfr

View 1yfr on RCSB PDB site
Description: crystal structure of alanyl-tRNA synthetase in complex with ATP and magnesium
Class: ligase
Keywords: alpha-beta fold, bent ATP conformation, magnesium bridge, ligase
Deposited on 2005-01-03, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (Start-453)
      • cloning artifact (454-457)
    Domains in SCOPe 2.07: d1yfra1, d1yfra2, d1yfra3
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (Start-453)
      • cloning artifact (454-457)
    Domains in SCOPe 2.07: d1yfrb1, d1yfrb2, d1yfrb3
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfrA (A:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfrA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfrB (B:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfrB (B:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal