PDB entry 1yfq

View 1yfq on RCSB PDB site
Description: High resolution S. cerevisiae Bub3 mitotic checkpoint protein
Class: signaling protein
Keywords: WD repeat WD40 repeat beta transducin repeat all beta, SIGNALING PROTEIN
Deposited on 2005-01-03, released 2005-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.152
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle arrest protein BUB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BUB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26449 (0-340)
      • cloning artifact (341)
    Domains in SCOPe 2.05: d1yfqa_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yfqA (A:)
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
acsdnilclatsddtfktnaaidqtielnassiyiifdyenp