PDB entry 1yfp

View 1yfp on RCSB PDB site
Description: structure of yellow-emission variant of gfp
Class: luminescence
Keywords: luminescence, green fluorescent protein, yellow-emission variant, bioluminescence, photoactive protein, fluorescent tag
Deposited on 1998-08-28, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yellow fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (0-226)
      • chromophore (63)
      • engineered (65)
      • engineered (69)
      • cloning artifact (77)
      • engineered (200)
    Domains in SCOPe 2.07: d1yfpa_
  • Chain 'B':
    Compound: yellow fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (0-226)
      • chromophore (63)
      • engineered (65)
      • engineered (69)
      • cloning artifact (77)
      • engineered (200)
    Domains in SCOPe 2.07: d1yfpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfpA (A:)
    kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
    tfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfpB (B:)
    kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
    tfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagi