PDB entry 1yfo

View 1yfo on RCSB PDB site
Description: receptor protein tyrosine phosphatase alpha, domain 1 from mouse
Deposited on 1996-12-11, released 1997-04-01
The last revision prior to the SCOP 1.69 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1yfoa_
  • Chain 'B':
    Domains in SCOP 1.69: d1yfob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfoA (A:)
    spstnrkypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknr
    yvnilpydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiwe
    qntativmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgd
    vtnrkpqrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtg
    tfvvidamldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehylygdtele
    vt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfoA (A:)
    kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
    ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
    vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
    tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
    rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfoB (B:)
    spstnrkypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknr
    yvnilpydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiwe
    qntativmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgd
    vtnrkpqrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtg
    tfvvidamldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehylygdtele
    vt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfoB (B:)
    kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
    ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
    vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
    tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
    rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly