PDB entry 1yfm

View 1yfm on RCSB PDB site
Description: recombinant yeast fumarase
Deposited on 1998-01-07, released 1998-07-08
The last revision prior to the SCOP 1.61 freeze date was dated 1998-07-08, with a file datestamp of 1998-07-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1yfm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1yfm_ (-)
    sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
    slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieilgg
    kigskqvhpnnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhi
    vkigrthlqdatpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpg
    fdvkiaeqisketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsg
    prcgyhelmlpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvf
    kpvmianllnsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaa
    skvaknahkkgitlkesalelgvltekefdewvvpehml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfm_ (-)
    sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
    slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieivhp
    nnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhivkigrthlq
    datpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpgfdvkiaeqi
    sketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsgprcgyhelm
    lpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvfkpvmianll
    nsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaaskvaknahk
    kgitlkesalelgvltekefdewvvpehml