PDB entry 1yfm

View 1yfm on RCSB PDB site
Description: recombinant yeast fumarase
Class: lyase
Keywords: lyase, fumarase, krebs cycle, active site water, hydratase, multi-subunit active site
Deposited on 1998-01-07, released 1998-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FUM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08417
      • engineered (288)
    Domains in SCOPe 2.07: d1yfma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfmA (A:)
    mlrftncscktfvkssyklnirrmnssfrtetdafgeihvpadkywgaqtqrsfqnfkig
    garermplplvhafgvlkksaaivneslggldpkiskaiqqaadevasgklddhfplvvf
    qtgsgtqsnmnanevisnraieilggkigskqvhpnnhcnqsqssndtfptvmhiaaslq
    iqnelipeltnlknaleakskefdhivkigrthlqdatpltlgqefsgyvqqvengiqrv
    ahslktlsflaqggtavgtglntkpgfdvkiaeqisketglkfqtapnrfealaahdaiv
    ecsgalntlacslfkiaqdirylgsgprcgyhelmlpenepgssimpgkvnptqnealtq
    vcvqvmgnnaaitfagsqgqfelnvfkpvmianllnsirlitdaaysfrvhcvegikane
    prihelltkslmlvtalnpkigydaaskvaknahkkgitlkesalelgvltekefdewvv
    pehmlgpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfmA (A:)
    sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
    slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieivhp
    nnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhivkigrthlq
    datpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpgfdvkiaeqi
    sketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsgprcgyhelm
    lpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvfkpvmianll
    nsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaaskvaknahk
    kgitlkesalelgvltekefdewvvpehml