PDB entry 1yfl

View 1yfl on RCSB PDB site
Description: T4Dam in Complex with Sinefungin and 16-mer Oligonucleotide Showing Semi-specific and Specific Contact and Flipped Base
Class: transferase/DNA
Keywords: t4dam, methyltransferase, DNA, protein-DNA complex, base-flipping, transferase-DNA complex
Deposited on 2005-01-03, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA adenine methylase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: dam
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04392 (0-258)
      • see remark 999 (138-139)
      • see remark 999 (208)
    Domains in SCOPe 2.07: d1yfla1
  • Chain 'B':
    Compound: DNA adenine methylase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: dam
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04392 (0-258)
      • see remark 999 (138-139)
      • see remark 999 (208)
    Domains in SCOPe 2.07: d1yflb1
  • Chain 'D':
    Compound: DNA adenine methylase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: dam
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04392 (0-258)
      • see remark 999 (138-139)
      • see remark 999 (208)
    Domains in SCOPe 2.07: d1yfld1
  • Chain 'E':
    Compound: DNA adenine methylase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: dam
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04392 (0-258)
      • see remark 999 (138-139)
      • see remark 999 (208)
    Domains in SCOPe 2.07: d1yfle1
  • Chain 'F':
    Compound: 5'-d(p*tp*cp*ap*cp*ap*gp*gp*ap*tp*cp*cp*tp*gp*tp*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(p*tp*cp*ap*cp*ap*gp*gp*ap*tp*cp*cp*tp*gp*tp*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(p*tp*cp*ap*cp*ap*gp*gp*ap*tp*cp*cp*tp*gp*tp*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: 5'-d(p*tp*cp*ap*cp*ap*gp*gp*ap*tp*cp*cp*tp*gp*tp*gp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yflA (A:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
    fniyhskekngtdevyifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yflA (A:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnngtd
    evyifn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yflB (B:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
    fniyhskekngtdevyifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yflB (B:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnngtd
    evyifn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yflD (D:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
    fniyhskekngtdevyifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yflD (D:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyn
    gtdevyifn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yflE (E:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
    fniyhskekngtdevyifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yflE (E:)
    mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
    rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
    gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
    ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkng
    tdevyifn
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.