PDB entry 1yfe

View 1yfe on RCSB PDB site
Description: Crystal structure of apo fumarase C from Escherichia coli
Class: lyase
Keywords: fumarase, kreb's cycle, apo, allosteric
Deposited on 2004-12-31, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarate hydratase class II
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yfea1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfeA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfeA (A:)
    vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
    llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
    merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
    igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
    rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
    cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
    mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
    iakkahkegltlkaaalalgylseaefdswvrpeqmv