PDB entry 1yfc

View 1yfc on RCSB PDB site
Description: Solution nmr structure of a yeast iso-1-ferrocytochrome C
Class: electron transport
Keywords: ferrocytochrome, mitochondrion, electron transport, respiratory chain, methylation
Deposited on 1996-08-08, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast iso-1-ferrocytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YEAST ISO-1-CYTOCHROME C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • modified residue (76)
      • engineered (106)
    Domains in SCOPe 2.07: d1yfca_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yfcA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase