PDB entry 1yfb

View 1yfb on RCSB PDB site
Description: The solution structure of the N-domain of the transcription factor abrB
Class: transcription
Keywords: nmr; homodimer; bioinformatics; swapped-hairpin barrel, transcription
Deposited on 2004-12-31, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transition state regulatory protein abrB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yfba_
  • Chain 'B':
    Compound: Transition state regulatory protein abrB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yfbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yfbA (A:)
mhhhhhhfmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

    Sequence, based on observed residues (ATOM records): (download) 
    >1yfbA (A:)
fmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1yfbB (B:)
mhhhhhhfmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

    Sequence, based on observed residues (ATOM records): (download) 
    >1yfbB (B:)
fmkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn