PDB entry 1yf9

View 1yf9 on RCSB PDB site
Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2
Class: structural genomics, unknown function
Keywords: SGPP, Structural Genomics, PSI, Protein Structure Initiative, ubiquitin conjugating enzyme, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-12-31, released 2005-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carrier protein 4
    Species: Leishmania major [TaxId:5664]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yf9a1
  • Chain 'B':
    Compound: Ubiquitin carrier protein 4
    Species: Leishmania major [TaxId:5664]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yf9b_
  • Chain 'C':
    Compound: Ubiquitin carrier protein 4
    Species: Leishmania major [TaxId:5664]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yf9c_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yf9A (A:)
    gpgsmsgagnlrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlh
    vqlpsdypfkspsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllr
    ypnpsdplnvqaahllhadrvgfdallrehvsthatpqkalesipeayrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf9A (A:)
    snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp
    sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa
    ahllhadrvgfdallrehvsthatpqkalesipeayrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yf9B (B:)
    gpgsmsgagnlrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlh
    vqlpsdypfkspsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllr
    ypnpsdplnvqaahllhadrvgfdallrehvsthatpqkalesipeayrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf9B (B:)
    lrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfk
    spsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnv
    qaahllhadrvgfdallrehvsthatpqkalesipeayrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yf9C (C:)
    gpgsmsgagnlrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlh
    vqlpsdypfkspsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllr
    ypnpsdplnvqaahllhadrvgfdallrehvsthatpqkalesipeayrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf9C (C:)
    snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp
    sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa
    ahllhadrvgfdallrehvsthatpqkalesipeayrph