PDB entry 1yf8

View 1yf8 on RCSB PDB site
Description: Crystal structure of Himalayan mistletoe RIP reveals the presence of a natural inhibitor and a new functionally active sugar-binding site
Class: hydrolase
Keywords: Himalayan mistletoe, ribosome inactivating protein, Viscum album, natural inhibitor, sugar-binding site, HYDROLASE
Deposited on 2004-12-31, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-galactoside-specific lectin 4
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yf8a_
  • Chain 'B':
    Compound: Beta-galactoside-specific lectin 4
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yf8b1, d1yf8b2
  • Heterogens: NAG, P6C, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yf8A (A:)
    yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
    ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
    kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
    lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yf8B (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpe
    qnqdqcltsgrdsvaginivscsggssgqrwvftnegailnlknglamdvanpglgqiii
    ypatgkpnqmwlpvp