SCOPe 2.08: Structural Classification of Proteins

PDB entry 1yf1

View 1yf1 on RCSB PDB site
Description: Structural and biochemical analysis of the link between enzymatic activity and oligomerization in AhpC, a bacterial peroxiredoxin.
Class: oxidoreductase
Keywords: peroxiredoxin, AhpC, Alkyl hydroperoxide reductase subunit C, OXIDOREDUCTASE
Deposited on 2004-12-29, released 2005-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1a1
Chain 'B':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1b_
Chain 'C':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1c_
Chain 'D':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1d_
Chain 'E':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1e_
Chain 'F':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1f_
Chain 'G':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1g_
Chain 'H':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1h_
Chain 'I':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1i_
Chain 'J':
Compound: Alkyl hydroperoxide reductase subunit C
Species: Salmonella typhimurium [TaxId:602]
Gene: AhpC
Database cross-references and differences (RAF-indexed):
- Uniprot P0A251 (0-End)
  - engineered (76)
Domains in SCOPe 2.08: d1yf1j_
Heterogens: NA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1yf1A (A:)
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki