PDB entry 1yf1

View 1yf1 on RCSB PDB site
Description: Structural and biochemical analysis of the link between enzymatic activity and oligomerization in AhpC, a bacterial peroxiredoxin.
Class: oxidoreductase
Keywords: peroxiredoxin, AhpC, Alkyl hydroperoxide reductase subunit C, OXIDOREDUCTASE
Deposited on 2004-12-29, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1a1
  • Chain 'B':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1b_
  • Chain 'C':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1c_
  • Chain 'D':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1d_
  • Chain 'E':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1e_
  • Chain 'F':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1f_
  • Chain 'G':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1g_
  • Chain 'H':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1h_
  • Chain 'I':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1i_
  • Chain 'J':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered (76)
    Domains in SCOPe 2.07: d1yf1j_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yf1A (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1A (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yf1B (B:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1B (B:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yf1C (C:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1C (C:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yf1D (D:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1D (D:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yf1E (E:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1E (E:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yf1F (F:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1F (F:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yf1G (G:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1G (G:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yf1H (H:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1H (H:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpge
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yf1I (I:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1I (I:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1yf1J (J:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yf1J (J:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfvhkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc