PDB entry 1yez

View 1yez on RCSB PDB site
Description: Solution structure of the conserved protein from the gene locus MM1357 of Methanosarcina mazei. Northeast Structural Genomics target MaR30.
Class: structural genomics, unknown function
Keywords: MaR30, Autostructure, Northeast Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-12-29, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mm1357
    Species: Methanosarcina mazei [TaxId:192952]
    Gene: Locus MM1357
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yeza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yezA (A:)
    mfreesrsvpveegevydvtiqdiarqgdgiariegfvifvpgtkvgdevrikvervlpk
    fafasvve