PDB entry 1yey

View 1yey on RCSB PDB site
Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913
Deposited on 2004-12-28, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.247
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yeyA (A:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyA (A:)
    mrtiialethdvrfptsremnpdpdysaayvvlrtdgaedlagyglvftigrgndvqtaa
    vaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdlaar
    aankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieqgyp
    ayttspgwdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdiamavdan
    qrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgehtqnrvvfk
    qllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqhlamadfv
    aitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefsypdgrfw
    vedla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yeyB (B:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyB (B:)
    mrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgn
    dvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaa
    wdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatl
    ieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaig
    pdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstg
    ehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcel
    vqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasia
    efsypdgrfwve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yeyC (C:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyC (C:)
    mrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgn
    dvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaa
    wdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatl
    ieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaig
    pdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstg
    ehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcel
    vqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasia
    efsypdgrfwvedla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yeyD (D:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyD (D:)
    mrtiialethdvrfptsresdamnpdpdysaayvvlrtdgaedlagyglvftigrgndvq
    taavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdl
    aaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieq
    gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi
    amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht
    qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh
    lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs
    ypdgrfwvedlaa