PDB entry 1yey

View 1yey on RCSB PDB site
Description: Crystal Structure of L-fuconate Dehydratase from Xanthomonas campestris pv. campestris str. ATCC 33913
Class: structural genomics, unknown function
Keywords: Structural Genomics, L-fuconate dehydratase, enolase superfamily, NYSGXRC target T2188, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-12-28, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.247
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-fuconate dehydratase
    Species: Xanthomonas campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P3K2 (3-End)
      • modified residue (3)
      • modified residue (28)
      • modified residue (111)
      • modified residue (113)
      • modified residue (247)
      • modified residue (264)
      • modified residue (368)
      • modified residue (378)
      • modified residue (416)
    Domains in SCOPe 2.07: d1yeya1, d1yeya2
  • Chain 'B':
    Compound: L-fuconate dehydratase
    Species: Xanthomonas campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P3K2 (3-End)
      • modified residue (3)
      • modified residue (28)
      • modified residue (111)
      • modified residue (113)
      • modified residue (247)
      • modified residue (264)
      • modified residue (368)
      • modified residue (378)
      • modified residue (416)
    Domains in SCOPe 2.07: d1yeyb1, d1yeyb2
  • Chain 'C':
    Compound: L-fuconate dehydratase
    Species: Xanthomonas campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P3K2 (3-End)
      • modified residue (3)
      • modified residue (28)
      • modified residue (111)
      • modified residue (113)
      • modified residue (247)
      • modified residue (264)
      • modified residue (368)
      • modified residue (378)
      • modified residue (416)
    Domains in SCOPe 2.07: d1yeyc1, d1yeyc2
  • Chain 'D':
    Compound: L-fuconate dehydratase
    Species: Xanthomonas campestris [TaxId:340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8P3K2 (3-End)
      • modified residue (3)
      • modified residue (28)
      • modified residue (111)
      • modified residue (113)
      • modified residue (247)
      • modified residue (264)
      • modified residue (368)
      • modified residue (378)
      • modified residue (416)
    Domains in SCOPe 2.07: d1yeyd1, d1yeyd2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yeyA (A:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyA (A:)
    mrtiialethdvrfptsremnpdpdysaayvvlrtdgaedlagyglvftigrgndvqtaa
    vaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdlaar
    aankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieqgyp
    ayttspgwdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdiamavdan
    qrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgehtqnrvvfk
    qllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqhlamadfv
    aitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefsypdgrfw
    vedla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yeyB (B:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyB (B:)
    mrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgn
    dvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaa
    wdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatl
    ieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaig
    pdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstg
    ehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcel
    vqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasia
    efsypdgrfwve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yeyC (C:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyC (C:)
    mrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgn
    dvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaa
    wdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatl
    ieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaig
    pdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstg
    ehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcel
    vqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasia
    efsypdgrfwvedla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yeyD (D:)
    gshmrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftig
    rgndvqtaavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavi
    naawdlaaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraart
    atlieqgypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlara
    aigpdiamavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpv
    stgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvgl
    celvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpa
    siaefsypdgrfwvedlaaskaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yeyD (D:)
    mrtiialethdvrfptsresdamnpdpdysaayvvlrtdgaedlagyglvftigrgndvq
    taavaalaehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdl
    aaraankplwrfiaeltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieq
    gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi
    amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht
    qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh
    lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs
    ypdgrfwvedlaa