PDB entry 1yew

View 1yew on RCSB PDB site
Description: crystal structure of particulate methane monooxygenase
Deposited on 2004-12-28, released 2005-02-08
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: particulate methane monooxygenase, B subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: particulate methane monooxygenase, A subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: particulate methane monooxygenase subunit C2
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: particulate methane monooxygenase, B subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: particulate methane monooxygenase, A subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: particulate methane monooxygenase subunit C2
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: particulate methane monooxygenase, B subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: particulate methane monooxygenase, A subunit
    Species: Methylococcus capsulatus [TaxId:243233]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: particulate methane monooxygenase subunit C2
    Species: Methylococcus capsulatus [TaxId:414]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, ZN, CUA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yewA (A:)
    hgeksqaafmrmrtihwydlswskekvkinetveikgkfhvfegwpetvdepdvaflnvg
    mpgpvfirkesyiggqlvprsvrleigktydfrvvlkarrpgdwhvhtmmnvqgggpiig
    pgkwitvegsmsefrnpvttltgqtvdlenynegntyfwhafwfaigvawigywsrrpif
    iprllmvdagradelvsatdrkvamgflaatilivvmamssanskypitiplqagtmrgm
    kplelpaptvsvkvedatyrvpgramrmkltitnhgnspirlgefytasvrfldsdvykd
    ttgypedllaedglsvsdnsplapgetrtvdvtasdaawevyrlsdiiydpdsrfagllf
    ffdatgnrqvvqidaplipsfm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yewB (B:)
    msaaqsavrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlw
    vtvtpivlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvf
    paslvpgaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsi
    adiqgynyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsn
    erflqst
    

    Sequence, based on observed residues (ATOM records):
    >1yewB (B:)
    avrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlwvtvtpi
    vlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvfpaslvp
    gaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsiadiqgy
    nyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsnerfl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yewC (C:)
    mhetkqggekrftgaicrcshrynsmevkmaattiggaaaaeaplldkkwltfalaiytv
    fylwvrwyegvygwsagldsfapefetywmnflyteivleivtasilwgylwktrdrnla
    altpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtivrdtdftpshiiefyls
    ypiyiitgfaafiyaktrlpffakgislpylvlvvgpfmilpnvglnewghtfwfmeelf
    vaplhygfvifgwlalavmgtltqtfysfaqgglgqslceavdegliak
    

    Sequence, based on observed residues (ATOM records):
    >1yewC (C:)
    lldkkwltfalaiytvfylwvrwyegvygwsagldsfapefetywmnflyteivleivta
    silwgylwktrdrnlaaltpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtiv
    rdtdftpshiiefylsypiyiitgfaafiyaktrlpffahtfwfmeelfvaplhygfvif
    gwlalavm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1yewE (E:)
    hgeksqaafmrmrtihwydlswskekvkinetveikgkfhvfegwpetvdepdvaflnvg
    mpgpvfirkesyiggqlvprsvrleigktydfrvvlkarrpgdwhvhtmmnvqgggpiig
    pgkwitvegsmsefrnpvttltgqtvdlenynegntyfwhafwfaigvawigywsrrpif
    iprllmvdagradelvsatdrkvamgflaatilivvmamssanskypitiplqagtmrgm
    kplelpaptvsvkvedatyrvpgramrmkltitnhgnspirlgefytasvrfldsdvykd
    ttgypedllaedglsvsdnsplapgetrtvdvtasdaawevyrlsdiiydpdsrfagllf
    ffdatgnrqvvqidaplipsfm
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1yewF (F:)
    msaaqsavrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlw
    vtvtpivlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvf
    paslvpgaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsi
    adiqgynyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsn
    erflqst
    

    Sequence, based on observed residues (ATOM records):
    >1yewF (F:)
    avrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlwvtvtpi
    vlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvfpaslvp
    gaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsiadiqgy
    nyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsnerfl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1yewG (G:)
    mhetkqggekrftgaicrcshrynsmevkmaattiggaaaaeaplldkkwltfalaiytv
    fylwvrwyegvygwsagldsfapefetywmnflyteivleivtasilwgylwktrdrnla
    altpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtivrdtdftpshiiefyls
    ypiyiitgfaafiyaktrlpffakgislpylvlvvgpfmilpnvglnewghtfwfmeelf
    vaplhygfvifgwlalavmgtltqtfysfaqgglgqslceavdegliak
    

    Sequence, based on observed residues (ATOM records):
    >1yewG (G:)
    lldkkwltfalaiytvfylwvrwyegvygwsagldsfapefetywmnflyteivleivta
    silwgylwktrdrnlaaltpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtiv
    rdtdftpshiiefylsypiyiitgfaafiyaktrlpffahtfwfmeelfvaplhygfvif
    gwlalavm
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1yewI (I:)
    hgeksqaafmrmrtihwydlswskekvkinetveikgkfhvfegwpetvdepdvaflnvg
    mpgpvfirkesyiggqlvprsvrleigktydfrvvlkarrpgdwhvhtmmnvqgggpiig
    pgkwitvegsmsefrnpvttltgqtvdlenynegntyfwhafwfaigvawigywsrrpif
    iprllmvdagradelvsatdrkvamgflaatilivvmamssanskypitiplqagtmrgm
    kplelpaptvsvkvedatyrvpgramrmkltitnhgnspirlgefytasvrfldsdvykd
    ttgypedllaedglsvsdnsplapgetrtvdvtasdaawevyrlsdiiydpdsrfagllf
    ffdatgnrqvvqidaplipsfm
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1yewJ (J:)
    msaaqsavrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlw
    vtvtpivlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvf
    paslvpgaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsi
    adiqgynyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsn
    erflqst
    

    Sequence, based on observed residues (ATOM records):
    >1yewJ (J:)
    avrshaeavqvsrtidwmalfvvffvivgsyhihamltmgdwdfwsdwkdrrlwvtvtpi
    vlvtfpaavqsylweryrlpwgatvcvlglllgewinryfnfwgwtyfpinfvfpaslvp
    gaiildtvlmlsgsylftaivgamgwglifypgnwpiiaplhvpveyngmlmsiadiqgy
    nyvrtgtpeyirmvekgtlrtfgkdvapvsaffsafmsiliyfmwhfigrwfsnerfl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1yewK (K:)
    mhetkqggekrftgaicrcshrynsmevkmaattiggaaaaeaplldkkwltfalaiytv
    fylwvrwyegvygwsagldsfapefetywmnflyteivleivtasilwgylwktrdrnla
    altpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtivrdtdftpshiiefyls
    ypiyiitgfaafiyaktrlpffakgislpylvlvvgpfmilpnvglnewghtfwfmeelf
    vaplhygfvifgwlalavmgtltqtfysfaqgglgqslceavdegliak
    

    Sequence, based on observed residues (ATOM records):
    >1yewK (K:)
    lldkkwltfalaiytvfylwvrwyegvygwsagldsfapefetywmnflyteivleivta
    silwgylwktrdrnlaaltpreelrrnfthlvwlvayawaiywgasyfteqdgtwhqtiv
    rdtdftpshiiefylsypiyiitgfaafiyaktrlpffahtfwfmeelfvaplhygfvif
    gwlalavm