PDB entry 1yep

View 1yep on RCSB PDB site
Description: Structural and biochemical analysis of the link between enzymatic activity and olgomerization in AhpC, a bacterial peroxiredoxin.
Class: oxidoreductase
Keywords: AHPC, Peroxiredoxin, peroxidase, OXIDOREDUCTASE
Deposited on 2004-12-28, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yepa_
  • Chain 'B':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yepb_
  • Chain 'C':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yepc_
  • Chain 'D':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yepd_
  • Chain 'E':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella typhimurium [TaxId:602]
    Gene: AhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yepe_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yepA (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yepA (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yepB (B:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yepB (B:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yepC (C:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yepC (C:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yepD (D:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yepD (D:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yepE (E:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yepE (E:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevc