PDB entry 1yem

View 1yem on RCSB PDB site
Description: Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, PSI, Protein Structure Initiative
Deposited on 2004-12-28, released 2005-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2H2 (9-End)
      • cloning artifact (8)
    Domains in SCOP 1.73: d1yema_
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2H2 (9-End)
      • cloning artifact (8)
    Domains in SCOP 1.73: d1yemb_
  • Heterogens: PT, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yemA (A:)
    mhhhhhhgseveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnl
    kkyyltfkeildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtl
    evnrvegigdfvdievisdspeeakekiwevakmlglkeedveprlylelinelsgrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yemA (A:)
    seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
    eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
    gdfvdievisdspeeakekiwevakmlglkeedveprlyleli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yemB (B:)
    mhhhhhhgseveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnl
    kkyyltfkeildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtl
    evnrvegigdfvdievisdspeeakekiwevakmlglkeedveprlylelinelsgrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yemB (B:)
    seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
    eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
    gdfvdievisdspeeakekiwevakmlglkeedveprlylelinel