PDB entry 1yel

View 1yel on RCSB PDB site
Description: Structure of the hypothetical Arabidopsis thaliana protein At1g16640.1
Class: structural genomics, unknown function
Keywords: CESG, Protein Structure Initiative, structural genomics, PSI, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-12-28, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: At1g16640
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FX77 (2-103)
  Domains in SCOPe 2.06: d1yela1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1yelA (A:)
  gsmadtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrg
  ekvfltvgwenfvkdnnledgkylqfiydrdrtfyviiyghnmc
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1yelA (A:)
  madtgevqfmkpfisekssksleiplgfneyfpapfpitvdlldysgrswtvrmkkrgek
  vfltvgwenfvkdnnledgkylqfiydrdrtfyviiyghnmc