PDB entry 1yei

View 1yei on RCSB PDB site
Description: catalytic antibody d2.3 complex
Class: immune system
Keywords: catalytic antibody d2.3 complex
Deposited on 1998-08-13, released 1999-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (ig antibody d2.3 (heavy chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1yeih1, d1yeih2
  • Chain 'L':
    Compound: protein (ig antibody d2.3 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1yeil1, d1yeil2
  • Heterogens: ZN, PGG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeiH (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeiL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec