PDB entry 1yei

View 1yei on RCSB PDB site
Description:
Deposited on 1998-08-13, released 1999-01-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1yeih1, d1yeih2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1yeil1, d1yeil2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeiH (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yeiL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec