PDB entry 1yeh

View 1yeh on RCSB PDB site
Description:
Deposited on 1997-05-29, released 1997-12-03
The last revision prior to the SCOP 1.65 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1yehh1, d1yehh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1yehl1, d1yehl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yehH (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yehL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilrgdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec