PDB entry 1yeh

View 1yeh on RCSB PDB site
Description: structure of igg2a fab fragment
Class: catalytic antibody
Keywords: catalytic antibody, immunoglobulin c region
Deposited on 1997-05-29, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yehh1, d1yehh2
  • Chain 'L':
    Compound: fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (1)
      • conflict (6)
      • conflict (9)
      • conflict (11)
      • conflict (13-14)
      • conflict (16-17)
      • conflict (23)
      • conflict (26)
      • conflict (26)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (50)
      • conflict (53-54)
      • conflict (57-59)
      • conflict (66-67)
      • conflict (85)
      • conflict (91)
      • conflict (93)
      • conflict (98)
      • conflict (107)
      • conflict (111)
      • conflict (113)
    Domains in SCOPe 2.07: d1yehl1, d1yehl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yehH (H:)
    emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
    nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yehL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
    sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilrgdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec