PDB entry 1yed

View 1yed on RCSB PDB site
Description: structure of a catalytic antibody igg2a fab fragment (d2.4)
Class: catalytic antibody
Keywords: catalytic antibody, transition state analogue
Deposited on 1997-04-15, released 1997-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.215
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 fab fragment (d.2.4)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (1)
      • conflict (6)
      • conflict (9)
      • conflict (11)
      • conflict (13-14)
      • conflict (16-17)
      • conflict (23)
      • conflict (26)
      • conflict (26)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (50)
      • conflict (54)
      • conflict (57-59)
      • conflict (67)
      • conflict (85)
      • conflict (91)
      • conflict (93)
      • conflict (98)
      • conflict (107)
      • conflict (111)
    Domains in SCOPe 2.06: d1yeda1, d1yeda2
  • Chain 'B':
    Compound: igg1 fab fragment (d.2.4)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yedb1, d1yedb2
  • Chain 'H':
    Compound: igg1 fab fragment (d.2.4)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yedh1, d1yedh2
  • Chain 'L':
    Compound: igg1 fab fragment (d.2.4)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (1)
      • conflict (6)
      • conflict (9)
      • conflict (11)
      • conflict (13-14)
      • conflict (16-17)
      • conflict (23)
      • conflict (26)
      • conflict (26)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (50)
      • conflict (54)
      • conflict (57-59)
      • conflict (67)
      • conflict (85)
      • conflict (91)
      • conflict (93)
      • conflict (98)
      • conflict (107)
      • conflict (111)
    Domains in SCOPe 2.06: d1yedl1, d1yedl2
  • Heterogens: PNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedA (A:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
    sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedB (B:)
    avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
    nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedH (H:)
    avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
    nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yedL (L:)
    divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
    sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleilradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec