PDB entry 1yeb

View 1yeb on RCSB PDB site
Description: structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein
Class: electron transport
Keywords: electron transport
Deposited on 1991-10-29, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00045 (0-105)
      • conflict (1)
      • conflict (4)
      • conflict (87)
      • conflict (102-103)
    Domains in SCOPe 2.04: d1yeba_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yebA (A:)
    tefkagsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytdanink
    nvkwdedsmseyltnpkkyipgtkmafgglkkekdrndlitylkkace