PDB entry 1yeb

View 1yeb on RCSB PDB site
Description: structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein
Deposited on 1991-10-29, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1yeb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yeb_ (-)
  tefkagsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytdanink
  nvkwdedsmseyltnpkkyipgtkmafgglkkekdrndlitylkkace