PDB entry 1yea

View 1yea on RCSB PDB site
Description: structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein
Class: electron transport
Keywords: electron transport
Deposited on 1991-10-29, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00045 (0-111)
  Domains in SCOPe 2.08: d1yeaa_
• Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yeaA (A:)
  akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda
  ninknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak