PDB entry 1ye9

View 1ye9 on RCSB PDB site
Description: Crystal structure of proteolytically truncated catalase HPII from E. coli
Deposited on 2004-12-28, released 2005-04-26
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Gene: katE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HDD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ye9A (A:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9A (A:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ye9B (B:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9B (B:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ye9C (C:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9C (C:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ye9D (D:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9D (D:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1ye9E (E:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9E (E:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1ye9F (F:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9F (F:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1ye9G (G:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9G (G:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1ye9H (H:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9H (H:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1ye9I (I:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9I (I:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1ye9J (J:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9J (J:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1ye9K (K:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9K (K:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1ye9L (L:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    

    Sequence, based on observed residues (ATOM records):
    >1ye9L (L:)
    senyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivhargsaa
    hgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteeg
    ifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvm
    wamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkpla
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1ye9M (M:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9M (M:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1ye9N (N:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9N (N:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1ye9O (O:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9O (O:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1ye9P (P:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgielt
    

    Sequence, based on observed residues (ATOM records):
    >1ye9P (P:)
    kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
    rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
    heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
    vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
    hidltlaqavaknlgi