PDB entry 1ye8

View 1ye8 on RCSB PDB site
Description: Crystal Structure of THEP1 from the hyperthermophile Aquifex aeolicus
Class: signaling protein, transferase
Keywords: mixed alpha-beta protein; rossmann fold, signaling protein, transferase
Deposited on 2004-12-28, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.174
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0334 kinase-like protein AQ_1292
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_1292
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67322 (0-177)
      • modified residue (0)
      • modified residue (110)
      • modified residue (125)
    Domains in SCOPe 2.07: d1ye8a1
  • Heterogens: MG, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ye8A (A:)
    mkiiitgepgvgkttlvkkiverlgkraigfwteevrdpetkkrtgfriittegkkkifs
    skfftskklvgsygvnvqyfeelaipilerayreakkdrrkviiideigkmelfskkfrd
    lvrqimhdpnvnvvatipirdvhplvkeirrlpgavlieltpenrdviledilsller
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye8A (A:)
    mkiiitgepgvgkttlvkkiverlgkraigfwteevrrtgfriittegkkkifsskffts
    kklvgsygvnvqyfeelaipilerayreakkdrrkviiideigkmelfskkfrdlvrqim
    hdpnvnvvatipirdvhplvkeirrlpgavlieltpenrdviledilsller