PDB entry 1ye5

View 1ye5 on RCSB PDB site
Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: ROSSMANN FOLD, TRNA SYNTHETASE, NUCLEOTIDE BINDING PROTEIN, PIN DOMAIN, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-12-28, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0500
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ye5a_
  • Chain 'B':
    Compound: hypothetical protein PH0500
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ye5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ye5A (A:)
    mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaef
    eilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkry
    epirrfgldtmpldkfikevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye5A (A:)
    plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
    ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
    pirrfgldtmpldkfikevelm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ye5B (B:)
    mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaef
    eilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkry
    epirrfgldtmpldkfikevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye5B (B:)
    plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
    ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
    pirrfgldtmpldkfikevelmvekel