PDB entry 1ye4

View 1ye4 on RCSB PDB site
Description: Crystal structure of the Lys-274 to Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD+
Class: oxidoreductase
Keywords: beta-alpha-barrel AKR aldo-keto reductase coenzyme specificity NAD, OXIDOREDUCTASE
Deposited on 2004-12-28, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (273)
    Domains in SCOPe 2.07: d1ye4a_
  • Chain 'B':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (273)
    Domains in SCOPe 2.07: d1ye4b_
  • Chain 'C':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (273)
    Domains in SCOPe 2.07: d1ye4c_
  • Chain 'D':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-321)
      • engineered (273)
    Domains in SCOPe 2.07: d1ye4d_
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ye4A (A:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye4A (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ye4B (B:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye4B (B:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ye4C (C:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye4C (C:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ye4D (D:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ye4D (D:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiaviprsnlperlvqnrsfntfdltkedfeeiakl
    diglrfndpwdwdnipifv