PDB entry 1ydw

View 1ydw on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at4g09670
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG, AT4G09670, UNKNOWN FUNCTION
Deposited on 2004-12-26, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4899999999999998 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AX110P-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g09670
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZ83
      • modified residue (11)
      • modified residue (105)
      • modified residue (125)
      • modified residue (129)
      • modified residue (248)
      • modified residue (309)
    Domains in SCOPe 2.08: d1ydwa1, d1ydwa2
  • Chain 'B':
    Compound: AX110P-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g09670
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZ83
      • modified residue (11)
      • modified residue (105)
      • modified residue (125)
      • modified residue (129)
      • modified residue (248)
      • modified residue (309)
    Domains in SCOPe 2.08: d1ydwb1, d1ydwb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydwA (A:)
    satetqirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkih
    gsyeslledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdacea
    ngvqimdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgld
    glgalgdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiy
    csflanltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtv
    ktelpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyqqisls
    gr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydwA (A:)
    qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
    lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
    mdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgal
    gdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsfla
    nltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktelp
    qeacmvrefarlvywpsisrktqlvvdavkesvdknyqqisls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydwB (B:)
    satetqirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkih
    gsyeslledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdacea
    ngvqimdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgld
    glgalgdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiy
    csflanltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtv
    ktelpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyqqisls
    gr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydwB (B:)
    qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
    lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
    mdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgal
    gdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsfla
    nltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktelp
    qeacmvrefaiknngakpdgywpsisrktqlvvdavkesvdknyqqisls