PDB entry 1ydu

View 1ydu on RCSB PDB site
Description: Solution NMR structure of At5g01610, an Arabidopsis thaliana protein containing DUF538 domain
Class: structural genomics, unknown function
Keywords: Arabidopsis, DUF538, structural genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2004-12-26, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At5g01610
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9M015 (1-169)
      • cloning artifact (0)
      • engineered (158)
    Domains in SCOPe 2.08: d1ydua1, d1ydua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yduA (A:)
sdqifnkvgsywlgqkankqfdsvgndlnsvstsieggtkwlvnkikgkmqkplpellke
ydlpigifpgdatnyefdeetkkltvlipsicevgykdssvlkftttvtghlekgkltdv
egiktkvmiwvkvtsistdaskvyftagmkksrsrdaygvqrnglrvdkf