PDB entry 1yds

View 1yds on RCSB PDB site
Description: Structure of CAMP-dependent protein kinase, alpha-catalytic subunit in complex with H8 protein kinase inhibitor [N-(2-methylamino)ethyl]-5-isoquinolinesulfonamide
Class: transferase/transferase inhibitor
Keywords: PHOSPHOTRANSFERASE, TRANSFERASE, CAMP, PHOSPHORYLATION, ISOQUINOLINE SULFONAMIDE, SERINE/THREONINE-PROTEIN KINASE, ATP-BINDING, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 1996-07-24, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: c-amp-dependent protein kinase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • conflict (123)
      • conflict (285)
    Domains in SCOPe 2.07: d1ydse_
  • Chain 'I':
    Compound: protein kinase inhibitor peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IQS, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ydsE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydsE (E:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.